DOG-1 / TMEM16A (Marker for Gastrointestinal Stromal Tumors); Clone DG1/447 & DOG-1.1 (Concentrate)

Species: Mouse
Immunogen: Recombinant human DOG-1 protein (DG1/447); A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
Clone: DG1/447 & DOG-1.1
Isotype: IgG1, kappa (DG1/447 & DOG-1.1)
Species Reactivity: Human. Others not known.
Positive Control: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Specificity: This monoclonal antibody recognizes Human DOG1. It is a sensitive and specific immunohistochemical marker for GIST, comparable with c-Kit, with the additional benefit of detecting c-Kit-negative GISTs. It is also a sensitive marker for unusual GIST subgroups lacking c-Kit or PDGFRA mutations.
Status: RUO